2. Cardiovascular Disease

Cardiovascular Disease

Cardiovascular Disease

Related Products

PDF 32.36 MB

Cardiovascular diseases (CVDs) are the leading causes of death and disability worldwide. CVDs include diseases of the heart, vascular diseases of the brain and diseases of blood vessels. Caused by atherosclerosis, coronary heart disease and cerebrovascular disease are the most common forms of CVDs. Other less common forms of CVDs include rheumatic heart disease and congenital heart disease. A large percentage of CVDs is preventable through the reduction of behavioral risk factors such as tobacco use, physical inactivity and unhealthy diet. Dietary sodium reduction can alleviate the long-term risk of cardiovascular disease events. Statin therapy is an effective intervention in both the primary and secondary preventions of CVDs in those who are at high risk.

Cat. No. Product Name CAS No. Purity Chemical Structure
  • HY-P0207
    Endothelin-2 (49-69), human 123562-20-9 98%
    Endothelin-2 (49-69), human (Endothelin-2 (human, canine)) is a 21-amino acid vasoactive peptide that binds to G-protein-linked transmembrane receptors, ET-RA and ET-RB.
    Endothelin-2 (49-69), human
  • HY-P0258
    Mas7 145854-59-7
    Mas7 (Mastoparan 7), a structural analogue of mastoparan, is an activator of heterotrimeric Gi proteins and its downstream effectors.
    Mas7
  • HY-P0318
    Hemorphin-7 152685-85-3 98%
    Hemorphin-7 is a hemorphin peptide, an endogenous opioid peptide derived from the β-chain of hemoglobin. Hemorphin peptides exhibits antinociceptive and antihypertensive activities, activating opioid receptors and inhibiting angiotensin-converting enzyme (ACE).
    Hemorphin-7
  • HY-P1025
    M40 143896-17-7 98%
    M40 is an antagonist or a weak agonist for galanin receptor depending on different subtypes of galanin receptors in the brain, hypothalamus, hippocampus, amygdala and pancreas.
    M40
  • HY-P1235
    Carperitide 89213-87-6 98%
    Carperitide (Atrial Natriuretic Peptide (ANP) (1-28), human, porcine) is a 28-amino acid hormone, that is normally produced and secreted by the human heart in response to cardiac injury and mechanical stretch. Carperitide (Atrial Natriuretic Peptide (ANP) (1-28), human, porcine) inhibits endothelin-1 secretion in a dose-dependent way.
    Carperitide
  • HY-P1490
    Bradykinin (2-9) 16875-11-9
    Bradykinin (2-9) is an amino-truncated Bradykinin peptide. Bradykinin (2-9) is a metabolite of Bradykinin, cleaved by Aminopeptidase P.
    Bradykinin (2-9)
  • HY-P1495
    Small Cardioactive Peptide B (SCPB) 84746-43-0 99.69%
    Small Cardioactive Peptide B (SCPB), a neurally active peptide, stimulates adenylate cyclase activity in particulate fractions of both heart and gill tissues with EC50s of 0.1 and 1.0 μM, respectively.
    Small Cardioactive Peptide B (SCPB)
  • HY-P1516
    Angiogenin (108-122) 112173-49-6 98%
    Angiogenin (108-122) is an angiogenin peptide.
    Angiogenin (108-122)
  • HY-P1542
    Urotensin I 83930-33-0 98%
    Urotensin I (Catostomus urotensin I), a CRF-like neuropeptide, acts as an agonist of CRF receptor with pEC50s of 11.46, 9.36 and 9.85 for human CRF1, human CRF2 and rat CRF2α receptors in CHO cells, and Kis of 0.4, 1.8, and 5.7 nM for hCRF1, rCRF2α and mCRF2β receptors, respectively.
    Urotensin I
  • HY-P1798
    Platelet Factor 4 (58-70), human 82989-21-7 99.89%
    Platelet Factor 4 (58-70), human, a peptide based on the amino acid sequence corresponding to residues 58-70 of platelet factor-4 (PF-4), contains the major heparin-binding domain, which is not sufficient for full antiangiogenic activity.
    Platelet Factor 4 (58-70), human
  • HY-P1985
    Notch 1 2408730-51-6
    Notch 1 (Notch homolog 1, translocation-associated) can encode a member of the NOTCH family of proteins. Members of this Type I transmembrane protein family share structural characteristics including an extracellular domain consisting of multiple epidermal growth factor-like (EGF) repeats, and an intracellular domain consisting of multiple different domain types.
    Notch 1
  • HY-P2196
    ELA-32(human) 1680205-79-1 98%
    ELA-32 (human) is a potent critical cardiac developmental peptide that acts through the G-protein–coupled apelin receptor.
    ELA-32(human)
  • HY-P2281
    Atrial natriuretic factor (1-28) (human, porcine) 91917-63-4 98%
    Atrial natriuretic factor (1-28) (human, porcine) exhibits blood pressure lowering activity by increasing sodium and urine excretion. Atrial natriuretic factor (1-28) (human, porcine) inhibits the release of pituitary adrenocorticotropic hormone (ACTH) and beta-endorphin through inhibition of pro-opiomelanocortin (POMC) expression. Atrial natriuretic factor (1-28) (human, porcine) increases cGMP levels in RMIC cells with an IC50 of 1.2 nM.
    Atrial natriuretic factor (1-28) (human, porcine)
  • HY-P2378
    Neuromedin U-25 (human) 312306-89-1 99.05%
    Neuromedin U-25 human is the active form of neuromedin U in human. Neuromedin U-25 human inhibits glucose-stimulated insulin secretion, which leads to early-onset obesity. Neuromedin U-25 serves as vasoconstrictor in human vascular beds.
    Neuromedin U-25 (human)
  • HY-P2538
    Big Endothelin-1 (1-38), human 120796-97-6 99.23%
    Big Endothelin-1 (1-38), human is the precursor of endothelin-1. Endothelin-1 (ET-1) is a potent vasopressor peptide.
    Big Endothelin-1 (1-38), human
  • HY-P2750
    Cathepsin D 9025-26-7
    Cathepsin D (CTSD) is a lysosomal aspartic protease encoded by the CTSD gene. Cathepsin D regulates lysosomal protease activity. Loss of Cathepsin D leads to lysosomal dysfunction and the accumulation of various cellular proteins associated with neurodegenerative diseases. Cathepsin D is involved in breast cancer metastasis. Cathepsin D can be used in research on diseases such as breast cancer and stroke.
    Cathepsin D
  • HY-P3019
    Urocortin III (human) 357952-09-1 98%
    Urocortin III (human) is a corticotropin-releasing factor (CRF)-related peptide. Urocortin III (human) preferentially binds and activates CRF-R2 and has a discrete central nervous system and peripheral distribution. Urocortin III (human) potently binds to type 2 CRF receptors, specifically mCRF2β (Ki = 13.5 nM) and rCRF2α (Ki = 21.7 nM), while demonstrating negligible affinity for hCRF1 (Ki >100 nM). Urocortin III (human) mediates somatostatin-dependent negative feedback control of Insulin (human) (HY-P0035) secretion[1][2].
    Urocortin III (human)
  • HY-P3142
    NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ
    NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.
    NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ
  • HY-P3460
    TDSRCVIGLYHPPLQVY 887973-01-5 98%
    TDSRCVIGLYHPPLQVY is a disordered control peptide. TDSRCVIGLYHPPLQVY is a peptide containing the same amino acids as LP17 (HY-P3400) but in a different sequence order.
    TDSRCVIGLYHPPLQVY
  • HY-P3533
    EILEVPST 239075-62-8 98.99%
    EILEVPST is a recombinant human fibronectinderived low-molecular-weight peptide fragment. EILEVPST can promote cell type-specific α4 integrin-mediated adhesion. EILEVPST can be used for the research of thrombogenesis.
    EILEVPST
Cat. No. Product Name / Synonyms Application Reactivity